SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085N9M0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085N9M0
Domain Number 1 Region: 276-409
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.32e-40
Family Regulator of G-protein signaling, RGS 0.0000195
Further Details:      
 
Domain Number 2 Region: 6-110
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.14e-18
Family DEP domain 0.012
Further Details:      
 
Domain Number 3 Region: 209-266
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.000000000183
Family Transducin (heterotrimeric G protein), gamma chain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085N9M0
Sequence length 506
Comment (tr|A0A085N9M0|A0A085N9M0_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD66166.1} KW=Complete proteome; Reference proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M513_02181 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MGSATFHKMDALCVQMMSPEIGLPVKGQKYFRTYVPASFTGNELIEWLISNLLDVDQAEA
LHLANQLCIFGYVFPVFEATASIKEDNCLFRLQIPYFWPSHNLQPDNVEYAIFLSKRLLR
NEERHGLVEHEAESYQRLRELLGHMWDFIQSQAEMQLKMFKEKKKADKVVFDSQEKAYWR
IHRPPPGTASCIEERYGKQEKKVKKKGSKDYQREIERLKQILKVKPWLKSAKSLETLVSW
CGQFANYDPMLTPPRDPANPWVVDDPTLWQLNANNVEVPTERRVRRWGFSIQELIKDPIG
RQVLETFLESEFSQENIKFWQAVQDLKYSPSSEVARKVEAIYNEFLVSGAPCQVNVDSQT
LESVNKSMHEKSIPLRYCFSQAEEHIFILMSKDSYPRFARSEIYKNMLAAAQQQGSKKLG
WSSFLFNHGPLKKGQPTRTSPQSFYKNKEEGSMGRLLTADFQATAKKAITETSESKLMVQ
SKSSPTFLVTSDVADPSSVDLDLSAK
Download sequence
Identical sequences A0A085N9M0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]