SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085NAZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085NAZ5
Domain Number 1 Region: 562-723
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.24e-36
Family G proteins 0.00000622
Further Details:      
 
Domain Number 2 Region: 396-520
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-33
Family cAMP-binding domain 0.0000045
Further Details:      
 
Domain Number 3 Region: 267-391
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.45e-32
Family cAMP-binding domain 0.00000451
Further Details:      
 
Domain Number 4 Region: 25-68
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000149
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085NAZ5
Sequence length 734
Comment (tr|A0A085NAZ5|A0A085NAZ5_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD66641.1} KW=Complete proteome; Reference proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M514_02894 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MRMTFRASTDSDDEDDPQKPVSNIVASYLRDHNIAGLMKKALIKLCLEMPDDPVRFLHLH
FARLYAKNTKEEDQAHVASFGRYGGSADVGRTIGERFMPRRGEATASSVGDEKTTAAVPP
QSPAAAAAVATSEGRLNTSLAAPQGSSIGVATMATWLCDFVQHVGEQEIVIYIHFHPAGL
TRVACCVPLGRTLFSETLTMQHPRHCCGHFSAVSSTSSNVPSSSRPEEEQAIDSDAGDAK
HRQRRGAVSAEVYSEEDVKNYVKKVVPKDDATKKALEKAMCQNVLFAHLDDNEKKDIFDA
MFPVEHQANEVIIRQGDQGDNFYVIDSGEADVFVNNKLTTTIKQHGSFGELALIYGTPRA
ATVKAKTAVKLWALDRDTYRRILMGSTMRKRKMYEEFLSKVKILEDLDKWERLTVADALE
PVSFTAGTVVVEQGQPGDEFFIILEGEVDVMQKRTEDSQPEVVGHLGPSDYFGEIALLLD
RPRAATVVAKTNLKCARMDRARFERVMGPCSEILKRNIANYNSWYVSYRGLTPIRGRLIC
QCQNAAQASDRKKNSYYGIPFGKSSITLQFTENRFPDSYDPTIANTFSKEFEFRGRSYQL
HLFDTAGQDEYSLFPRSYSVGVHGYVLVYAINSRKSFEVVKVIYDKILDSVGYTGDVSVV
PIILVGNKLDLQQVEREVSADEGRKTAEKWKASFLETTAKDNHRIRELFERLLFQVEKAH
GNIRDTKESSCILS
Download sequence
Identical sequences A0A085NAZ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]