SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085NIG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085NIG5
Domain Number 1 Region: 50-165
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-21
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 2 Region: 180-231
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000327
Family TSP-1 type 1 repeat 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085NIG5
Sequence length 254
Comment (tr|A0A085NIG5|A0A085NIG5_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD69261.1} KW=Complete proteome; Reference proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M513_04535 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MNEIYCSHVCPPLNCQRGGYTDPKRCSRCRCPDGFTGKLCDQVMPGFDANCGGLVKVNSR
WVYFNSPNYPKAFKAGQECSWLFKAPPGLRVELEFIERFDIYCKAEHSLCMDYIEVRNSS
DFANTGMRLCCHNIPRQKIYSSTTDMLVLFRSFYRSGLGFRARARAVHKTTRWRYRRSVP
PTGEWSQWGAWSSCSVSCGGCGVQTRQRDCPQGSLCAGEAVETNTCGQQPCETCKEERMV
SISCGLWGLFRCEG
Download sequence
Identical sequences A0A085NIG5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]