SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085NSA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085NSA3
Domain Number 1 Region: 973-1259
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.41e-37
Family APH phosphotransferases 0.015
Further Details:      
 
Domain Number 2 Region: 581-665
Classification Level Classification E-value
Superfamily PX domain 7.46e-17
Family PX domain 0.0013
Further Details:      
 
Domain Number 3 Region: 382-527
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.71e-16
Family Regulator of G-protein signaling, RGS 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A085NSA3
Sequence length 1260
Comment (tr|A0A085NSA3|A0A085NSA3_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD72349.1} KW=Complete proteome; Reference proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M514_11603 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MEDAEDASSAVLAGGFNIFRVFKSGKLCALIAALLALQSFGLYGCSCIVLCTLFFLIGCF
VRLFFYVWNVRYPMLLRDFDAIDWTSEKKFILPKLKAVTFDKNAKLPCSENVEKLINEIV
DYTIRDYVTSWYSKLTNDDGFIKSVRCLFITALRVLIVGLKNVNWVTVLTHDVIDDFATH
LRLFRKAKQKYDKVVSTGSEPRPDLLEQYFFEMEYELESSFCRKRLSMSKQGENEFLRSL
GDVLVYLLLPTKDLSPHLFRLLLRDVLAVQVIGGTVNLICDPDYICHTVATLLFTVPLKY
EDFITVLEATDDADELNGTMESLQQEIELQRSKDTGGADDSLIKQQLGSLFYLQKLIAGR
LSRLQTSDSSLDEAGDGWQDCAAMYDLSLAFVLCNHVALCSFIDYLSQTDGKTYIDMYLT
GFKNSFPHPSGRSSGDHVRANESLIISSAREVALEIYNQYFQAKSDRLVDIDEGIKKRLQ
AMIRSKVHPSLWFDEAQQRAYEILENDIRFYPSFKRSAAYVKLLAELKLLLPQDKSDETN
PFSIPPTTSVLGDQADSSEVDSATVKDFVYETNIKTIGMGNEQSTIFAVYNIEVKKFDHR
GQCMKHWIVTRRYSDFYNLNCVIKRKFPQLAKISFPAKKTFNNMHHGFLERRKRALNTYL
KVRLHIANSPCRSSVAKSAPLQTLLDPALLKRCKGLENLLLEFLCRMDYNGDGGTLVEKL
NSVVDPIRSGVKFVGNAVISMPDTLIDGVCKVGDGLGKVTRTVFGIQELTPSQVENFGGR
VAASLNYESADSIPLRILMLLVDEIFGLQEQNQWIRRRMVSFLQQLIHAMYGSSLNRKIV
EYVHWLTSEEQVTNYVKLFRNSMWPNGVLAESAPVRPQSTKARTRVVARTQTLSLLPDEF
KLFIGNDSTTAGVCMVFEALQHECLNRRLCYVLLERLIVSVFPNRNVDQSISRMNTSDEA
ELRNSLETETLTVYGQRGGGCINQGCGYMTDNGPIFVKLNRDQKASIMFKGEFASLAALY
AANCVIPIVRGALFAAEYIDGMSRLNKYAALLGKQLARLHLHNSQLLKAQSERESWVTDR
HDDFTIEPVTKFGFHETTCCGFIPMDNRWSDDWVEFFTQKRLQAQYDKVMSDSGDRRLSE
LWPRVLEKIPSCFENCGEIVPCLLHGDLWSGNVAETPSGPVIFDPASFYGHSEFEFGIAS
IFGGFNRQFYDAYYELIPKRPGFEKRLRLYALFNYLNHWNHFGSAYRESTLREMKAIIDS
Download sequence
Identical sequences A0A085NSA3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]