SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085NUN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085NUN6
Domain Number 1 Region: 158-217
Classification Level Classification E-value
Superfamily Chromo domain-like 2.14e-17
Family Chromo domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A085NUN6
Sequence length 235
Comment (tr|A0A085NUN6|A0A085NUN6_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD73182.1} KW=Complete proteome; Reference proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M513_04806 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MSTRQRKNVKTDGGSAEAKSESANPKVGKVEAVGDSSKAVDESAKNVDDAAKSADRSAKS
ETSTSAVPPSQHRVLRPRGFRRSVKELFALTQYCVYSRSRKRSSSSQPKVVKAESPANAK
KPKLAPIPEVPETDVSQEEGEVGPSSSVTEKPDTLPSNGFERGLTVEAIIAALDITGDKM
FLVKFKNQEQLELIPLNTAKRLCPQVVIAFYEARLRLQWTQNGSAPHILSMDDDT
Download sequence
Identical sequences A0A085NUN6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]