SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085U489 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085U489
Domain Number 1 Region: 89-214
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.38e-42
Family PH0987 C-terminal domain-like 0.0000104
Further Details:      
 
Domain Number 2 Region: 5-92
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 0.00000000144
Family PH0987 N-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A085U489
Sequence length 218
Comment (tr|A0A085U489|A0A085U489_YERRU) Allophanate hydrolase 2 subunit 1 {ECO:0000313|EMBL:CEK26912.1} KW=Complete proteome; Reference proteome OX=29486 OS=Yersinia ruckeri. GN=CSF007_5755 OC=Yersiniaceae; Yersinia.
Sequence
MQRARCYLLGESAVVLELEPPVTLENQQRIWGLADRLIHHPDVREAIPGMNNLTLLLENP
QQTAWDAIERLQRWWEDGESLQLESRDIDIPVIYGGAAGPDLDEVARHTGLTPRQVVACH
SAASYIVYFLGFQPGFSYLGGMPEALSTPRRAEPRLVVVPGSVGIGGSQTGIYPLATPGG
WQLIGRTALALFNPLEMPPTLLRPGDNVRFVPMKEGVC
Download sequence
Identical sequences A0A085U489
WP_038244502.1.81699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]