SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085U6F3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085U6F3
Domain Number 1 Region: 7-221
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.41e-83
Family Phosphate binding protein-like 0.0000000195
Further Details:      
 
Domain Number 2 Region: 222-311
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 7.85e-28
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A085U6F3
Sequence length 315
Comment (tr|A0A085U6F3|A0A085U6F3_YERRU) Pre-uroporphyrinogen synthase {ECO:0000256|HAMAP-Rule:MF_00260} KW=Complete proteome; Reference proteome OX=29486 OS=Yersinia ruckeri. GN=nADLYRO1b_1817 OC=Yersiniaceae; Yersinia.
Sequence
MTMSDKIIRIATRQSPLAMWQAHYVQQLLQTCHSGLKVELVPMVTRGDIILDTPLAKVGG
KGLFVKELELALLEDRADIAVHSMKDVPIAFPQGLGLVTICERDDPRDAFVSNNYQRMDD
LPAGSIVGTSSLRRQCQLRQRRPDLIVKDLRGNVGTRLSKLDQGDYDAIILAVAGLNRLG
LKDRIRYAMSPEESLPAVGQGAVGIECRLDDNLTRALLAPLNHRPTELRVCAERAMNTRL
EGGCQVPIGSYAILEDDTLWLRALVGAPDGSQMICGERRGPATHAEQMGIELADELLSRG
AKAILALVYQDNPPL
Download sequence
Identical sequences A0A085U6F3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]