SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085UDH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085UDH2
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.92e-33
Family AadK N-terminal domain-like 0.00072
Further Details:      
 
Domain Number 2 Region: 137-276
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.28e-21
Family AadK C-terminal domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085UDH2
Sequence length 279
Comment (tr|A0A085UDH2|A0A085UDH2_9STAP) Streptomycin resistance protein {ECO:0000313|EMBL:KFE41235.1} KW=Complete proteome OX=985762 OS=Staphylococcus agnetis. GN=SAGN_08995 OC=Staphylococcus.
Sequence
MRTELEIFEMILNIGEQDERIEAILLNGSRANPNSVKDKFQDYDIIFSTYYINEIIKQKD
WYKQFGDILIMQEPDFRIDKKQYDIYTYLMQFQDMTRIDLRLMNPDYISSSMDDAYSKVL
LDKTGEYQAFNFNKEYEMYVTKLATQNEFNKIINEIYWVSTYVVKGIIRKDYMYAEHMIS
IPVKTAFIELLKQYILTFNFLKEFNFGKVNQRVTEHQEIKDILMKINCNNSLEAIKANIN
YIIEKTNELAIKISGKQGFKYNKAEYEAVKMYINNLKIK
Download sequence
Identical sequences A0A085UDH2
WP_037567158.1.79999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]