SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085WM04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085WM04
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.11e-16
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A085WM04
Sequence length 156
Comment (tr|A0A085WM04|A0A085WM04_9DELT) Uncharacterized protein {ECO:0000313|EMBL:KFE68717.1} KW=Complete proteome; Reference proteome OX=394096 OS=Hyalangium minutum. GN=DB31_7954 OC=Cystobacterineae; Archangiaceae; Hyalangium.
Sequence
MNALLEEVSRHHFPNPPATPEQIEAFERRMGWRLDPELRAFYLHCDGAALFRRRPDADYR
FLSLAEIQRARVAIRGKDDDSRGPASMYTICDLQDGDYILVDISRQQGGCYPILDGWHEA
WPDPEYCKQIAHSFSGFLEGALRSGGNWFWLQQRES
Download sequence
Identical sequences A0A085WM04
WP_044189701.1.76193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]