SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085WXA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085WXA2
Domain Number 1 Region: 58-126
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0000000102
Family Subtilase propeptides/inhibitors 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085WXA2
Sequence length 128
Comment (tr|A0A085WXA2|A0A085WXA2_9DELT) Uncharacterized protein {ECO:0000313|EMBL:KFE72315.1} KW=Complete proteome; Reference proteome OX=394096 OS=Hyalangium minutum. GN=DB31_0577 OC=Cystobacterineae; Archangiaceae; Hyalangium.
Sequence
MLRLTRIGLALVSCLALTACGSGLVPGNNPETDARMVLFAASCESPAPLHLAPSDKVPDS
YIIVFDESLEGTFDRVSELEQKYGFTADTKWQAALKGFAATLTPELVGALRCEADVDYID
ENSYVQAD
Download sequence
Identical sequences A0A085WXA2
WP_044181489.1.76193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]