SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085ZGA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085ZGA4
Domain Number 1 Region: 3-125
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000392
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A085ZGA4
Sequence length 227
Comment (tr|A0A085ZGA4|A0A085ZGA4_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:KFF03468.1} KW=Complete proteome; Reference proteome OX=362418 OS=Flavobacterium reichenbachii. GN=IW19_21535 OC=Flavobacteriaceae; Flavobacterium.
Sequence
MNYIQKIKRLYALSEKENYGFSEAEILQLEKKLATLIPARLKEYYLELGREENLNYHYNR
LMKPEEIEFSEDNFLVIYEENQNVAIWGIKKDDLKLDNPPVYGNYGTIEKSDWILETQTL
EDFFLSMAIYNGTFGGLKYNGNYFGEIISEILKDFETNWNFIPEISWEKQKNYTNDFYDV
ISLSFDQNQNCVAVFIGTSDQERFDYILEQIDIDWSYLSYDDDEEED
Download sequence
Identical sequences A0A085ZGA4
WP_084679192.1.23404 WP_084679192.1.82313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]