SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085ZN11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085ZN11
Domain Number 1 Region: 32-97,130-204
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000693
Family SMI1/KNR4-like 0.0038
Further Details:      
 
Domain Number 2 Region: 239-405
Classification Level Classification E-value
Superfamily ARM repeat 0.0000115
Family PBS lyase HEAT-like repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085ZN11
Sequence length 448
Comment (tr|A0A085ZN11|A0A085ZN11_9FLAO) Glucan biosynthesis protein {ECO:0000313|EMBL:KFF05825.1} KW=Complete proteome; Reference proteome OX=362418 OS=Flavobacterium reichenbachii. GN=IW19_09950 OC=Flavobacteriaceae; Flavobacterium.
Sequence
MIDQKTLNQIERIKTKLILAKEIDNDFEVFAADRHKYLIGETISSEEILKFERSYTISLP
ESYKAFLQYIGNGGISNQNAAAGPGYGIFLFGKNIAEFVYSNPENFLKQDCKVYPEMSDN
FWKELNMKIDEDISDEDFEYELGKIFSGILPIGTEGCTYYYGLVLNGEFKGRVVNIDIDR
RKPYFAFESDFLDWYERWLDEITAEKINDNNDLFNHTLGGVVTHILDVYNAADVEETKLE
CLIAILKKKEIASQALDVLEKKYKSSEGVIQHKLLQVLTKFDYNRAYPYLIDFAKNDILS
VFQFVFWYAKDKSLDWLEFIKENIQRINDEKTFQFCTYLLKEMKLDYGIMIIPFSLNENK
EIRRQFYYSLGQLENKRDYLDTFIIGLNDNSNWVVHAALQALNGIKDEKLLVHYKAVAEK
FSKEQDYILPNLSRNLEFFGLTLAEIKL
Download sequence
Identical sequences A0A085ZN11
WP_035683576.1.82313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]