SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086A3N5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086A3N5
Domain Number 1 Region: 61-106
Classification Level Classification E-value
Superfamily TrpR-like 0.0000732
Family Trp repressor, TrpR 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086A3N5
Sequence length 108
Comment (tr|A0A086A3N5|A0A086A3N5_9FLAO) Transposase {ECO:0000313|EMBL:KFF11299.1} KW=Complete proteome; Reference proteome OX=445961 OS=Chryseobacterium soli. GN=IW15_16235 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MEKLIPDYKRIYTDIIIKDFPDKRDCCMRLLQKESLSVVDIIELNEKIFGFPDKETFAAN
QRHRSYRKTDILKILDYQKKNQLNNKQLALHFKLSRNTVTKWKKRFVV
Download sequence
Identical sequences A0A086A3N5
WP_034713242.1.53842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]