SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086AKF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086AKF8
Domain Number 1 Region: 3-181
Classification Level Classification E-value
Superfamily Heme oxygenase-like 2.78e-29
Family Heme oxygenase HemO (PigA) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086AKF8
Sequence length 183
Comment (tr|A0A086AKF8|A0A086AKF8_9FLAO) Heme oxygenase {ECO:0000313|EMBL:KFF17172.1} KW=Complete proteome OX=1233950 OS=Chryseobacterium sp. JM1. GN=IW22_21255 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MVSEYLKQNTAEYHDAAEKLFNSEKIFNKTFTLEDYKKIIHTNYLMLLHSEDKIFGSLSD
KYSEKLQLNNRKKLSLIEKDLESLSLENQTVSHDLEFDNEHEALGAMYVIEGSTLGGNVI
AKQLSKTEGFDNVTFNFFGCYQENTGPMWKNFKEVLDTEVAEDNYNEVLSGAKKLYTFLL
NVN
Download sequence
Identical sequences A0A086AKF8 A0A1M4WEM4
WP_034730454.1.13141 WP_034730454.1.15450 WP_034730454.1.77208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]