SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086AWV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086AWV0
Domain Number 1 Region: 20-172
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.11e-29
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086AWV0
Sequence length 178
Comment (tr|A0A086AWV0|A0A086AWV0_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:KFF21164.1} KW=Complete proteome OX=1233950 OS=Chryseobacterium sp. JM1. GN=IW22_09175 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MELQFFKDFDFTDFRNESSYSVRDYIEPFPDDELIASVEEELGYKLPASYIELMKLQNGG
LVEKSCFPTTEENSWADDHIAITGIMGIGREKTYSICGELGSQFMIEEWGYPAIGIYICD
CPSAGHDMVLLDYSNCGKDGEPEVVHIDQENDYQKIFLAKDFETFIKGLKDEDEFDGE
Download sequence
Identical sequences A0A086AWV0
WP_034725766.1.15450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]