SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086BL57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086BL57
Domain Number 1 Region: 143-286
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 7.69e-39
Family AadK C-terminal domain-like 0.00012
Further Details:      
 
Domain Number 2 Region: 1-136
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.09e-27
Family AadK N-terminal domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086BL57
Sequence length 288
Comment (tr|A0A086BL57|A0A086BL57_9FLAO) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:KFF29671.1} KW=Complete proteome; Reference proteome OX=558152 OS=Chryseobacterium piperi. GN=IQ37_04455 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MKAREEKLKQIINWAKENPDIRTVLLTSSLVNPYAPVDDFSDLDVELVFEGMKPYESDKK
WIECFGTPISMVEEDETFFDGKHAMKMVLYEDHVKVDFKLYEKSEFIKEVDGETLPEDWD
VGYKVLIDKDDLTKELKPPTHQSIMIKKPTEQRFQQLINDFWWDTTYVAKCLKRDDIFYA
KFMMEDVIRTDYLVPMLEWYIASEKEWNNITTNKHGRLFKKYLSPELWKQVEATFSGSSI
EDNWNALFACADLVHEVGTFLAKKIGSPYPLEMENKVRKYLNEIKEKY
Download sequence
Identical sequences A0A086BL57
WP_034682171.1.69742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]