SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086F363 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086F363
Domain Number 1 Region: 5-44
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.000000000000753
Family AadK C-terminal domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086F363
Sequence length 45
Comment (tr|A0A086F363|A0A086F363_CHRP1) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:KFF73377.1} KW=Complete proteome OX=1517683 OS=Chryseobacterium sp. (strain P1-3). GN=HX13_20700 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
TYQSIMIQKPDEQKFRQLINDFWWDTTYVAKCLKRGDIFYAKFYV
Download sequence
Identical sequences A0A086F363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]