SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086F6Q3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086F6Q3
Domain Number 1 Region: 3-59
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000222
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086F6Q3
Sequence length 90
Comment (tr|A0A086F6Q3|A0A086F6Q3_CHRP1) Uncharacterized protein {ECO:0000313|EMBL:KFF74617.1} KW=Complete proteome OX=1517683 OS=Chryseobacterium sp. (strain P1-3). GN=HX13_11070 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MKNWWNENWIPIFHNGGGDYICYDLKGIFTGNKGQILEFWNRDYDRNIIATSLEDFLDLL
NSYYEEKSGDLDEFLTVENRKGYPRKFNVG
Download sequence
Identical sequences A0A086F6Q3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]