SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086J8R1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A086J8R1
Domain Number - Region: 81-114
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0706
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086J8R1
Sequence length 145
Comment (tr|A0A086J8R1|A0A086J8R1_TOXGO) Dpy-30 motif protein {ECO:0000313|EMBL:KFG28529.1} KW=Complete proteome OX=943119 OS=Toxoplasma gondii p89. GN=TGP89_280510 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MRSSVLSSAPETRGSVSGGEECVSVARGSITEGENGQVSPASASVDPSSPSARQRNMSEL
DRAALGERPPKLSVQSLPIRQYLDLMVVPALLPALTVLVNERPEQPIEFLAHWLLENGPK
YAARESVSGPGADSAALSALLGRGI
Download sequence
Identical sequences A0A086J8R1 A0A086JJI7 A0A086JVZ4 A0A086LL31 A0A086PIF1 A0A086PTN7 A0A125YUX4 A0A125YUX5 A0A139Y0N5 A0A2G8Y4P4 B9Q221
gb|TGVEG_079770 XP_018637215.1.89292 gi|211969109|gb|EEB04305.1| gi|237844295|ref|XP_002371445.1| gb|TGME49_080510 gb|TGGT1_072800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]