SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086J9I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086J9I8
Domain Number 1 Region: 105-155
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000183
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086J9I8
Sequence length 223
Comment (tr|A0A086J9I8|A0A086J9I8_TOXGO) Putative thrombospondin type 1 domain protein {ECO:0000313|EMBL:KFG28806.1} KW=Complete proteome OX=1130820 OS=Toxoplasma gondii GAB2-2007-GAL-DOM2. GN=TGDOM2_319992 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MLRQPTKSNRNGRRFWKVEFVLYPDGNGAAETYDADPNLFSEEVLRKIGAALQGPPTTLS
QLITQCMPSDEDTNHIATYSAENLEDIAEGRTTCSLFAGLAPHGCHCQVTAWSEWTACDK
QCSQRTARRSRSIQHAEAFIDPAVDCPPLTEERPCAGSTKIFQVNLPAGVSLGTEAQRAA
QFEYCAPDLLATLAKVSQEAWQEKEGEEEEMKTDGKRGRNGGN
Download sequence
Identical sequences A0A086J9I8 A0A086KHB6 A0A125YSB1 A0A151HBW5 S8FCX5
XP_018638051.1.89292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]