SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086JWG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086JWG8
Domain Number 1 Region: 19-154
Classification Level Classification E-value
Superfamily VPS9 domain 0.0000000000889
Family VPS9 domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086JWG8
Sequence length 172
Comment (tr|A0A086JWG8|A0A086JWG8_TOXGO) Vacuolar sorting 9 (VPS9 domain ) protein {ECO:0000313|EMBL:KFG36486.1} KW=Complete proteome OX=943167 OS=Toxoplasma gondii FOU. GN=TGFOU_281570B OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MKLKTLRENLPFLHERLQVKPVLRNVPLQASAAILDQLSTWRLPEQKTACLAWVVRSVQN
ACRKHVRLVHGQQRRAEMERKETRVSPPPPQPVEITVDDLVGLLLVTAALSQGRLLLANL
WVMNLFNLQRPREAQFDEASFHLTTLQSALSFACVVSVPQTQTTPRRGEPQM
Download sequence
Identical sequences A0A086JWG8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]