SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086K0K0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086K0K0
Domain Number 1 Region: 631-674
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000327
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Weak hits

Sequence:  A0A086K0K0
Domain Number - Region: 143-187
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000126
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086K0K0
Sequence length 969
Comment (tr|A0A086K0K0|A0A086K0K0_TOXGO) Microneme protein MIC14 {ECO:0000313|EMBL:KFG37918.1} KW=Complete proteome OX=943119 OS=Toxoplasma gondii p89. GN=TGP89_218310 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MSEAAYSAERGWDPETMTCKCPNDAPACSAEQATYNLINHSSVALGQGAICAAATGTVSG
IARHFKRSTLDLCGDLSKLSPLSWEQLPLPPYMADDVILDDEVIRSGHYLCTKSYHHVFC
PSSLITTSTTTPEPKWDWPARQDCVPGEWTSWSKCSMDCYVGSGALPVKSRSRSVLVDRR
GTGNVCVLEDHTLCKVGSEVPYCEDLCWITDWGDWSGCEQKVLQIGQAAVRARTKLRHIF
MGTGGVCSSDHIQYDYSGCKSGMDSSGGREDDSAHSMVEQKSRVTDAGCKKSSGWSACSL
PCQQPGANAVTQQFQLGLPETVTASTTSYCASRSRACVEKKPPCVLDVAPDCSLVKPRYD
SPEEALYCHELCNNALTRCREQAALQFQTQWECIMAFINSSGVTGRCQIQKGAVSKTTLR
PPVCFLSRTRQVDASKSLSFLTTDKTSGRGSCMCAVTNSVPCSPEEVALSFDDWAKQLGS
TVCPFGQLGAFFNSPNSKGSADSFVYFGASDLGRVHCPISKSSDLGSRFPTFTEFESPES
MNNFCENGLPFWQEKREPLVDCRQVIPKNASTTDCPGRCHKAVVNCMVSNDSLDNCINEA
LSAGDFAENCELQSSVKLGKGLMFCKRIRTDCEYSEWSEWSECSRTCRSGGDDEESVRVR
GRKLLVAAEHGGSCDADIEDSHGGSLSDVQLCDWLPPCDALADTETYVIMPKPEPKLADW
SATRTTTTTVIPDLQNENKILCTIVDMADFSKSHRGYDTETESCKCPYNARVCSRTEAVN
SRDNWDELMQTVCESNGQGQILAQGMETFSCSDRVFRSFRGTLGQTPEAHCKSEDATYIF
CEDGAIDNDLIFTEVMMSIITGVVMGIAVVYWAIQYSGDVQKVLGLAGRYVELTNLLHEV
SQEPQAHEEEKAEEGEGPDEDAEPEAAVEGNSEFDCNPRAKEENGEESEQDASDSESGSD
DDDDIVSEE
Download sequence
Identical sequences A0A086K0K0 A0A086KSU9 A0A086L263 A0A086M7B4 A0A086PY02 A0A125YT23 B9PQE4
gb|TGGT1_029040 gb|TGVEG_071430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]