SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086KB99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086KB99
Domain Number 1 Region: 46-116
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 1.03e-19
Family Zn-finger domain of Sec23/24 0.00047
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.57e-19
Family beta-sandwich domain of Sec23/24 0.0015
Further Details:      
 
Domain Number 3 Region: 133-206
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000589
Family Trunk domain of Sec23/24 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086KB99
Sequence length 208
Comment (tr|A0A086KB99|A0A086KB99_TOXGO) Sec23/Sec24 trunk domain-containing protein {ECO:0000313|EMBL:KFG41667.1} KW=Complete proteome OX=943167 OS=Toxoplasma gondii FOU. GN=TGFOU_291680A OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MDVHEHEAATGCRFSWNVWPATRAEAQKIELPLGCMFTPLRDCTSLQLVEYEPVRCRVSG
CILNPFCAIDFRSKQWTCPFSLQRNAFPNHYAMHISEQNLPAELLYPTIEYILPQPMPAA
NAPGVSAGESLPPPLFFLVVDTCVIEEELDQLRDSLMQALALMPSDAMVGIITYGAMAML
HELGGGSENVDVMKAHVFRGNKELTSTQ
Download sequence
Identical sequences A0A086KB99 A0A086KCM6 A0A139Y1P3 A0A151HK81

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]