SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086KLU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A086KLU8
Domain Number - Region: 54-88
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.000118
Family Mitotic arrest deficient-like 1, Mad1 0.012
Further Details:      
 
Domain Number - Region: 10-44
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0149
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086KLU8
Sequence length 95
Comment (tr|A0A086KLU8|A0A086KLU8_TOXGO) c-Myc-binding family protein {ECO:0000313|EMBL:KFG45366.1} KW=Complete proteome OX=943167 OS=Toxoplasma gondii FOU. GN=TGFOU_305220 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MADPVELQKQEFKKYLEDHGVLQQLSRVLVGLYEEPDRPLNALDYIKKYLGAPTGADIDA
LRSEVDSLKKENAGLKARVEQLQQEVDTLRQDLEA
Download sequence
Identical sequences A0A086J8H9 A0A086JM94 A0A086KLU8 A0A086LRH4 A0A086PQE4 A0A086Q365 A0A125YN03 A0A139Y199 A0A2G8XPS5 S7VQM6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]