SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086L2R1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086L2R1
Domain Number 1 Region: 150-265
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase II 8.72e-28
Family Peptidyl-tRNA hydrolase II 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086L2R1
Sequence length 266
Comment (tr|A0A086L2R1|A0A086L2R1_TOXGO) Peptidyl-tRNA hydrolase PTH2 domain-containing protein {ECO:0000313|EMBL:KFG50929.1} KW=Complete proteome OX=943167 OS=Toxoplasma gondii FOU. GN=TGFOU_219240 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MWRGNSSPFQLSGSCGLSPNRVAWKRLPGLPRAPLFPSRCSLFPSSLSLGHPKRPPTITR
QACSVGRRVETITKVQQFSVFLKPHSTMNISSGGIFSLSSDAPSSAAGMQTSTQHQQADN
NAQAEDTIGVKTENGKVEGTKEKRQAGRPDPIVQYVLLRKDLQTALGWPTGAVIAQACHA
CISVVASAYSEPDVQAYLAEGDNMRKVVLEVHSEEDLRKISETLDTKDICHKLWIEQPEG
IPTCVAIQPMRRSKVNSLLKSFKLYS
Download sequence
Identical sequences A0A086K1N0 A0A086KTG4 A0A086L2R1 A0A086M7L3 A0A086PXQ5 A0A125YY26 S7V235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]