SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086L987 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086L987
Domain Number 1 Region: 92-188
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 1.22e-24
Family FAD-dependent thiol oxidase 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086L987
Sequence length 204
Comment (tr|A0A086L987|A0A086L987_TOXGO) Sulfhydryl oxidase {ECO:0000256|RuleBase:RU371123} KW=Complete proteome OX=943167 OS=Toxoplasma gondii FOU. GN=TGFOU_288620 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MSSRGKGDVFSSPGSEAAVSLDLAHGNQASRNLPASSTPTPNGRSSAPASHSAAAALLAS
QVFPQKLNQCVDAACRDRILKDDAPQDEDDDPPDRMSIGRAAWSFLHSSAATWKDDPATA
DQHRRGEWLKSFFALFPCVHCRTHFAPYLQTHPPVVSGGRTSLSVWTCEAHNHVNESLQR
PAFPCDAAQLIRQWKAVQWSEDDD
Download sequence
Identical sequences A0A086J9R4 A0A086KEK6 A0A086L987 A0A086M116 A0A086Q876 A0A125YQC5 A0A125YQC6 A0A139Y2H8 A0A151HJA3 A0A2G8Y3D7 B6KKC9
gb|TGME49_088620 gb|TGVEG_082380 XP_002368302.1.89292 gi|211965966|gb|EEB01162.1| gi|237838009|ref|XP_002368302.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]