SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086LEL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086LEL5
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily Ribosomal protein L13 0.00000000000000288
Family Ribosomal protein L13 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086LEL5
Sequence length 98
Comment (tr|A0A086LEL5|A0A086LEL5_TOXGO) Putative 50S ribosomal protein L13 {ECO:0000313|EMBL:KFG55083.1} KW=Complete proteome OX=943167 OS=Toxoplasma gondii FOU. GN=TGFOU_225240B OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
HPAGPKIITAKTIMARNPAMILNLAVKRMLPPNRLRPIMYRKLFVYAGALHPHWQVPQVI
VPAKTPAEVSFLPFSVERADPVQAAARIAALGDRMKME
Download sequence
Identical sequences A0A086LEL5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]