SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086LYJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086LYJ2
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 5.36e-20
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00072
Further Details:      
 
Domain Number 2 Region: 79-169
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000206
Family Cold shock DNA-binding domain-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086LYJ2
Sequence length 207
Comment (tr|A0A086LYJ2|A0A086LYJ2_TOXGO) DNA-directed RNA polymerase II RPB7 {ECO:0000313|EMBL:KFG61710.1} KW=Complete proteome OX=935652 OS=Toxoplasma gondii RUB. GN=TGRUB_271300 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MFFVVEQWHNVALRPAQLGRRYTQYVETLLRQQVEGKCLHNLGYIICVIRIVHMEAGRVQ
DGTGMVIVAARYQAIAFKPFKDEVLDAVITDVNKLGLFAQCGPLKVFVSRASLPPSFVYQ
DDSAVGCMTDGEVELRVDSDIRLRLLGVRYDSMNLFAIATINESYLGPIHHSNLGGQGNA
ALFGGLGSSDFAASQSSPLQSPHSPTL
Download sequence
Identical sequences A0A086KGE9 A0A086L5S9 A0A086LYJ2 A0A086PGM4 A0A086QVD2 A0A125YSA3 B9PI55
gb|TGGT1_110170 gb|TGVEG_018570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]