SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086M5A6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086M5A6
Domain Number 1 Region: 100-136
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000017
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086M5A6
Sequence length 163
Comment (tr|A0A086M5A6|A0A086M5A6_TOXGO) Uncharacterized protein {ECO:0000313|EMBL:KFG64074.1} KW=Complete proteome OX=935652 OS=Toxoplasma gondii RUB. GN=TGRUB_273065 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MADASRRSSGSSWCGCSGNTSGQQETQRESCDRRVLGVSPRADETPLNTFFAKPISASDR
TVSSDDCGDVLRGGATTLTAEQQLVQRKSQVELMIENERYLRHHAELQEMLALFMTKVLE
DKPNNILKFAGEFFTQDGLKELVEAQADEEDTYSGIDEKLEEV
Download sequence
Identical sequences A0A086KFA0 A0A086L0J4 A0A086L4Z7 A0A086M5A6 A0A086QGF0 S7V3B4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]