SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086M7S8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086M7S8
Domain Number 1 Region: 10-95
Classification Level Classification E-value
Superfamily HMG-box 1.57e-23
Family HMG-box 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086M7S8
Sequence length 98
Comment (tr|A0A086M7S8|A0A086M7S8_TOXGO) HMG (High mobility group) box domain-containing protein {ECO:0000313|EMBL:KFG64946.1} KW=Complete proteome OX=935652 OS=Toxoplasma gondii RUB. GN=TGRUB_219828 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MAPKKVTKKGTEGKKKRAKKDPNAPKKPLSSYMFFAKDKRAEILKKQPSLKSDIGKVGKM
IGEEWAKLSSSQKMTYQKKAEQEKIRYQREMSLYNKKK
Download sequence
Identical sequences A0A086K2G1 A0A086KTT6 A0A086L398 A0A086M7S8 A0A086PXE2 A0A086QST6 A0A125YMH0 A0A151HD11 A0A2G8XP48 S7V1V4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]