SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086MB55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086MB55
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily SNARE-like 1.01e-39
Family Clathrin coat assembly domain 0.0000414
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086MB55
Sequence length 143
Comment (tr|A0A086MB55|A0A086MB55_TOXGO) AP complex subunit sigma {ECO:0000256|PIRNR:PIRNR015588} KW=Complete proteome OX=935652 OS=Toxoplasma gondii RUB. GN=TGRUB_313450 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MIRFVLLLNRQGKTRLSRWYEGGLSDQEKWKVESGVQAAVLQRQRRWANILDFRSYHLVY
RQYAGLVFVVCIDSRENDLAVYEGIQLFVEMLDKYFGTVCELDIIFHVDKVYFLLDQFIQ
AGEIVQTSPKLIVSRAKRLDGLD
Download sequence
Identical sequences A0A086JZA2 A0A086L056 A0A086LHL4 A0A086MB55 A0A086QB52 A0A086QYV2 A0A125YFX3 A0A125YFX4 A0A139Y8V3 A0A151H8A0 A0A2G8XZY9 B9PIL1
gb|TGVEG_098510 XP_018635424.1.89292 gb|TGGT1_089850 gi|211962220|gb|EEA97415.1| gi|237830517|ref|XP_002364556.1| gb|TGME49_113450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]