SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086MTC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086MTC9
Domain Number 1 Region: 7-165
Classification Level Classification E-value
Superfamily Lipocalins 4.96e-42
Family Rv2717c-like 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086MTC9
Sequence length 191
Comment (tr|A0A086MTC9|A0A086MTC9_9ACTN) UPF0678 fatty acid-binding protein-like protein FM21_28640 {ECO:0000256|HAMAP-Rule:MF_01297} KW=Complete proteome; Reference proteome OX=1915400 OS=Streptomyces luteus. GN=FM21_28640 OC=Streptomyces.
Sequence
MIEIPSDLHKDLVPLAFLLGHWSGAGVHDFPGAEKCNFGQEVSFTHDGRDFLEYQSHTWV
LDQEGNKVRPLESEHGFWRIDPNRKVEVTMVRDDGVIEIWYGEMADQKPQIDLVTDAVAR
TAASQPYTGGKRLYGYVKSDLMWVGEKQTPEVELRPYMSAHLKKVVTPEDVERWAKALPD
DMPDDGIAFFK
Download sequence
Identical sequences A0A086MTC9
WP_043382002.1.42235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]