SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086PKT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086PKT8
Domain Number 1 Region: 292-402
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-19
Family Nucleotide and nucleoside kinases 0.0016
Further Details:      
 
Domain Number 2 Region: 91-215
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000195
Family Nucleotide and nucleoside kinases 0.0012
Further Details:      
 
Domain Number 3 Region: 49-89
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000178
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086PKT8
Sequence length 412
Comment (tr|A0A086PKT8|A0A086PKT8_TOXGO) Adenylate kinase {ECO:0000313|EMBL:KFH00970.1} KW=Complete proteome OX=943118 OS=Toxoplasma gondii MAS. GN=TGMAS_307603 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MDVLVAENGAQGKHALVPLVASSVAAPPSVPSNVVTDPQFAAERKAFMEETTEFVEKYHI
NELFNDLLKELILNYPDNPIEHLIDYLERPPSLRVVIIGPQACVGSQRSELCDKLADTHG
LIHIHAGRLIRAYLKKSDSGLLSHCIQKGELVPDSIAIDAVLPIIRKNGRRGCVINGFPR
TRVQAVALQESRIVPDKFIILTVPGRDLQVYFQLLPTTEEHEANAARNSLVDETCHNTPQ
ASRMLGYEQAEKQCSTKARAYERHISGVMQQYASAYHTISTSATLDETLQKIRVLGPVGS
GKSTQAKLLADWYGVVHVDAQQLVRELALKDEKLRTVLHESEEKGTLLPQEFVLPPILNR
LRQADCSSRGWVLEGFPQTCSQAEWLRNMRLTPTQVIALDIDAVSQAITGDA
Download sequence
Identical sequences A0A086PKT8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]