SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086QEW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A086QEW0
Domain Number - Region: 10-44
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0191
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086QEW0
Sequence length 49
Comment (tr|A0A086QEW0|A0A086QEW0_TOXGO) ATP:guanido phosphotransferase, carboxy-terminal catalytic domain protein {ECO:0000313|EMBL:KFH11142.1} KW=Complete proteome OX=933077 OS=Toxoplasma gondii VAND. GN=TGVAND_231605 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MFRQRTKEQEDIRHYCETQQLPQLLALLLNRLAQKKDPHPKLFAVGSRS
Download sequence
Identical sequences A0A086QEW0 S7V2U2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]