SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086QS53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086QS53
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily t-snare proteins 5.49e-32
Family t-snare proteins 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086QS53
Sequence length 209
Comment (tr|A0A086QS53|A0A086QS53_TOXGO) Syntaxin protein {ECO:0000313|EMBL:KFH15435.1} KW=Complete proteome OX=943118 OS=Toxoplasma gondii MAS. GN=TGMAS_209820B OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MIRKTKGALQVIKEENLLFTRRFPEKISEGRIRFNMHQIVARHLQQITVECQQAETEYKT
VIKKRICRQVKIVYPEASAEEVEQLVESGDLSAAAAVKMRVTGTHQSLRNAVADLQDKYR
DILRLEQSVAELHQMFVELAFLVDQQGELLDQIQYNVTNARDYTAQAEKELLQARKNQQS
AKKRMCWLSVCILVLVIIILVPVILNIVK
Download sequence
Identical sequences A0A086QS53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]