SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086QWQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086QWQ6
Domain Number 1 Region: 100-136
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000017
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086QWQ6
Sequence length 163
Comment (tr|A0A086QWQ6|A0A086QWQ6_TOXGO) Uncharacterized protein {ECO:0000313|EMBL:KFH17038.1} KW=Complete proteome OX=943118 OS=Toxoplasma gondii MAS. GN=TGMAS_273065 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MADASRRSSGSSWCGCSGNTSGQQETQRESCDRRVLGVSPRADETPLSTFFAKPISASDR
TVSSDDCGDVLRGGATTLTAEQQLVQRKSQVELMIENERYLRHHAELQEMLALFMTKVLE
DKPNNILKFAGEFFTQDGLKELVEAQADEEDTYSGIDEKLEEV
Download sequence
Identical sequences A0A086QWQ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]