SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086T0W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086T0W0
Domain Number 1 Region: 21-163
Classification Level Classification E-value
Superfamily GINS helical bundle-like 4.19e-42
Family SLD5 N-terminal domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 168-221
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.000085
Family SLD5 C-terminal domain-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086T0W0
Sequence length 221
Comment (tr|A0A086T0W0|A0A086T0W0_ACRC1) DNA replication complex GINS protein SLD5 {ECO:0000256|PIRNR:PIRNR007764} KW=Complete proteome; Reference proteome OX=857340 OS=23072 / IMI 49137). GN=ACRE_062520 OC=Hypocreales incertae sedis; Acremonium.
Sequence
MDIDDILREVDPATGGIPRETSDLQSLARLWVAERSAPELLDWPSGGLFERVNDRIKSQI
EKVEDMTGDMDPKTNFSLIVIQTELERYKFLVRSYLRARLAKIDKHTLHYLSSQELRRRL
SPTELAYATRHQALLHNHYLSSFLASFPQQLQNLNDTAGGVSMIDSPDLDTAVFIRMLRD
RHVHGQGTDTDNTLSAESGDVLIIRWSSAKPLVDEGDAELV
Download sequence
Identical sequences A0A086T0W0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]