SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086TAN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086TAN5
Domain Number 1 Region: 12-64,166-247
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.49e-23
Family Regulator of G-protein signaling, RGS 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086TAN5
Sequence length 362
Comment (tr|A0A086TAN5|A0A086TAN5_ACRC1) Uncharacterized protein {ECO:0000313|EMBL:KFH46417.1} KW=Complete proteome; Reference proteome OX=857340 OS=23072 / IMI 49137). GN=ACRE_027050 OC=Hypocreales incertae sedis; Acremonium.
Sequence
MADHPPMATPSPQPDLTRNRLPTLFEVLSRRTLPPVDLFSFYIYMRDQQRSVDYLDFWLD
VAQHMSLCRHYVRELRRSVMIGTPDLDKASSKRSSMILDSMGDLEPRVPGPSMYATEKEK
NQDAQMSAFLREEAHESPLSGSQPARPSPQFSTPRDLTTESNSPGHTVSREDIRASAEKI
LYLFLLPGAEREITLPGSITQDVTVAIEEMGRDDPEVFDVAKDYVFQAMERDAFPGFLRM
KALGNLIPPTLVMRLIVGLLAMFGAFWAAFILIFLDKTRATRCWLILPFTVGVYFLASYQ
YSLDPILALLGFSEYTSFNFSRIREPYIRKLLSKRALMVLGVTLLVDAALCVLFILVPGK
RL
Download sequence
Identical sequences A0A086TAN5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]