SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086W8B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086W8B7
Domain Number 1 Region: 8-161
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 1.83e-64
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A086W8B7
Sequence length 169
Comment (tr|A0A086W8B7|A0A086W8B7_9BURK) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome OX=1549812 OS=Massilia sp. BSC265. GN=JN27_18050 OC=Oxalobacteraceae; Massilia.
Sequence
MSKSDKPVVGVIMGSSSDWDVMKNAVDILKQFGVPFEAQVISAHRMPDEMFTYAETARER
GLRAIIAGAGGAAHLPGMVAAKTIVPVLGVPVPSKYLRGEDSLLSIVQMPKGVPVSTFAI
GEAGAANAALTAVAILAATDEALAQRLLAFRAEQTAAAQAMTLPVLTHE
Download sequence
Identical sequences A0A086W8B7
WP_036251371.1.28810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]