SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086YD91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086YD91
Domain Number 1 Region: 16-187
Classification Level Classification E-value
Superfamily Heme oxygenase-like 1.14e-26
Family Heme oxygenase HemO (PigA) 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A086YD91
Sequence length 191
Comment (tr|A0A086YD91|A0A086YD91_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:KFI32241.1} KW=Complete proteome; Reference proteome OX=195105 OS=Haematobacter massiliensis. GN=CN97_07100 OC=Rhodobacteraceae; Haematobacter.
Sequence
MPGEKGSMMTDMPRRWHLRAATHASHDAVDRVVGGVDTLAGYGDYVLALHRFRAVVETAL
KGIVLPEGLRGWQPASVAPALLSDMGDLDLAPLPPLSGGPLLDARGETAYGTLYVLEGAT
LGAQVLLRRAQKLGLTSQHGARHLALQAGRVPQWREFLTRLEAESDFDLGLAATASSACF
ALAQNAFGKTE
Download sequence
Identical sequences A0A086YD91
WP_051910912.1.45337 WP_051910912.1.66515 WP_051910912.1.71246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]