SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A086ZIK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A086ZIK4
Domain Number 1 Region: 2-87
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000445
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A086ZIK4
Sequence length 261
Comment (tr|A0A086ZIK4|A0A086ZIK4_9BIFI) Uncharacterized protein {ECO:0000313|EMBL:KFI46354.1} KW=Complete proteome OX=78343 OS=Bifidobacterium boum. GN=BBOU_1445 OC=Bifidobacterium.
Sequence
MAYQEVQNLLNEYELLLQHIGIDTAARLAPPISDREIADLEEQYQIRLTQDAKAFWQWHN
GGEPRSAMPGFFQSLSETLATHKEDREIVCESFDHEPDPQEWDECCECQSHNPTGDLTYN
HGARGVVAPFDISLYTAEGFRYCAIFDCGDPDAIDTMTYGVRITDCNQSWVSPEYPKTFA
DRIRNWMTAIRTGVWYPCHLNGQGDTVFLVTCEYQPGGSTTDTYDYESVEFMPSNWQPDM
AEFRPFPGNNPISDEHPAVDE
Download sequence
Identical sequences A0A086ZIK4
WP_026502346.1.16490 WP_026502346.1.46760 WP_026502346.1.7203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]