SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087B5E0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087B5E0
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.27e-33
Family Chaperone J-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 129-209
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 5.1e-17
Family DnaJ/Hsp40 cysteine-rich domain 0.00018
Further Details:      
 
Domain Number 3 Region: 258-344
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.44e-16
Family HSP40/DnaJ peptide-binding domain 0.001
Further Details:      
 
Domain Number 4 Region: 109-164,212-266
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0000000000000102
Family HSP40/DnaJ peptide-binding domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087B5E0
Sequence length 381
Comment (tr|A0A087B5E0|A0A087B5E0_BIFLN) Chaperone protein DnaJ {ECO:0000256|HAMAP-Rule:MF_01152} KW=Complete proteome OX=1695 OS=Bifidobacterium longum subsp. suis. GN=BLSS_2041 OC=Bifidobacterium.
Sequence
MADYYETLGVERGASDDEIKKAYRKLSRKYHPDIAGPEFEDKFKEVNNAYDVLSNPDKRR
MYDSGVDPNDPNAGAGGFSGAGFGDMSDVFSTFFGSAFGGGSQGPVPRTQPGRDALASAS
IDLKTAVFGGTAHVKISTFSLCQECGGSGAQGGAQPVTCPDCHGQGFMQKVVRTMLGQMM
TSAPCERCEGHGTIIKNPCPSCMGHGRVRTTRTVGVTVPAGINDNARLRLSNQGEVGEGG
GAAGDLYIDIRIKADKQFTRDGDDLHCWIQVPMSWAVLGHDLSIDTFDGEKTVSIPAGCQ
PEDTVTLKGLGVTNIRNKDERGNLIAHVNVLIPTKLNETERGLIEQFAASHDSGATHVSQ
ASRPQAGQKKGFFSKLKDALS
Download sequence
Identical sequences A0A087B5E0
WP_032684227.1.29792 WP_032684227.1.39030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]