SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087D8K7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087D8K7
Domain Number 1 Region: 21-121
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 0.0000876
Family MgtE membrane domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087D8K7
Sequence length 215
Comment (tr|A0A087D8K7|A0A087D8K7_9BIFI) Uncharacterized protein {ECO:0000313|EMBL:KFI91857.1} KW=Complete proteome; Reference proteome OX=1437607 OS=Bifidobacterium saguini DSM 23967. GN=BISA_1145 OC=Bifidobacterium.
Sequence
MKFNTNAPFWRFMDTLVHFTALNLLYLLTLVPVITIGPARAALYSTMFAYDENDDISLTR
EYLRRFKREFKHGLISGIIIMVLVAAIIFGLAFWSAWNTNASYIPLIVLIIAAVIVVLTA
EYLFPMQARFENSLGTQWKLAAMFPWRAFPCTLALLGIDVVLLAVAYFIPFIRVLVLIFG
VAWGAYAKSLVFLWGLKRYGGMGPVEQPTYINAHD
Download sequence
Identical sequences A0A087D8K7
WP_033891611.1.30812 WP_033891611.1.58889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]