SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087DX71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087DX71
Domain Number 1 Region: 29-146
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000641
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087DX71
Sequence length 148
Comment (tr|A0A087DX71|A0A087DX71_9BIFI) SMI1 / KNR4 family protein {ECO:0000313|EMBL:KFJ00122.1} KW=Complete proteome OX=212365 OS=Bifidobacterium thermacidophilum subsp. porcinum. GN=BPORC_0896 OC=Bifidobacterium.
Sequence
MVAEEGFTDRERMRARQIAADLTQLDGTQLNPGATDAEISEFERSNGVALPVSFRSWLEI
SDGGRLLFPEGIELYGVIHPPLLELDDPYTPEGGWLVVGMMPDTDLVLVSLKGEATVVYN
REGGTFDDAVCYGDFLAFLEDILRQWSD
Download sequence
Identical sequences A0A087DX71
WP_052363280.1.49252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]