SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087FWA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087FWA5
Domain Number 1 Region: 107-207
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-20
Family B3 DNA binding domain 0.014
Further Details:      
 
Domain Number 2 Region: 211-306
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-18
Family B3 DNA binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087FWA5
Sequence length 307
Comment (tr|A0A087FWA5|A0A087FWA5_ARAAL) Uncharacterized protein {ECO:0000313|EMBL:KFK21907.1} KW=Complete proteome; Reference proteome OX=50452 OS=Arabis alpina (Alpine rock-cress). GN=AALP_AAs63571U000500 OC=Arabis.
Sequence
MFYAGYLSNEENGGDDKDNTELARKKKARMTNLQTKVGPSSSGISCFVAFVTASNLNSDS
LYLPIDFTSSDAIKRKYGKIVLTDGRETSWEMDLNIFYENEKSRVRGQNRFVKLTLTEDC
LKSSRLYIPLTFMREHGLNKPGMITLLGKNGMKTAANVREESMGRVSLGRGWNDFAKANA
LKIDDTFMMELFWDNGTPVLSLLSSESKSHTGFVTLTLTDDNVRKSRVHLPMPFVRANGL
VKPGMMTLISKDGTRSLAKLLRVSSTGRMSLGRGFKEFVIGNGLIIGESFTFELVWENET
PMLSLCN
Download sequence
Identical sequences A0A087FWA5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]