SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087GBN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087GBN7
Domain Number 1 Region: 72-153
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0001
Family PB1 domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087GBN7
Sequence length 167
Comment (tr|A0A087GBN7|A0A087GBN7_ARAAL) Auxin-responsive protein {ECO:0000256|RuleBase:RU004549} KW=Complete proteome; Reference proteome OX=50452 OS=Arabis alpina (Alpine rock-cress). GN=AALP_AA8G363100 OC=Arabis.
Sequence
MNSFEPQSQDSMKRRFHQDKTTTQSTPFMSKPISINPNSNSTSGTAGRFPRFGLNVEDDL
VSSVVPPVTVVLEGRSICQRISLDKHGSYHSLAMALRQMFVDGADSASDTDNLDLSNAIP
GHLIAYEDMENDLLLAGDLSWKDFVRVAKRIRILPVKGNTRKVRRNE
Download sequence
Identical sequences A0A087GBN7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]