SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087GHF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087GHF6
Domain Number 1 Region: 93-283
Classification Level Classification E-value
Superfamily TRAF domain-like 4.05e-47
Family SIAH, seven in absentia homolog 0.000073
Further Details:      
 
Domain Number 2 Region: 28-82
Classification Level Classification E-value
Superfamily RING/U-box 0.0000118
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087GHF6
Sequence length 308
Comment (tr|A0A087GHF6|A0A087GHF6_ARAAL) E3 ubiquitin-protein ligase {ECO:0000256|RuleBase:RU201113} KW=Complete proteome; Reference proteome OX=50452 OS=Arabis alpina (Alpine rock-cress). GN=AALP_AA7G116100 OC=Arabis.
Sequence
MEMDCIENDEIHRNGTYHLSSTKTQGGATVTNSVYELLDCPVCTFSMYPPIHQCHNGHTL
CSTCKVRVHNRCPTCRQQLGDIRCLALERVAESLVLPCKYYNLGCPQIFPYYSKLKHESL
CNLRPYSCPYAGSECGTVGDIPFLVAHLRDDHKVDMHSGSTFNHRYVKSNPLEVENATWM
LTVFHCFGQYFCLHFEAFQLGMGPVYMAFLRFMGDEEDARSYSYSLEVGGSGRKLTWEGT
PRSIRDSHRKVRDSNDGLIIQRSMALFFSGGDRKELKLRVTGKVWKEQHNPDSGISIPNI
SLPDHSVV
Download sequence
Identical sequences A0A087GHF6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]