SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087GTK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087GTK2
Domain Number 1 Region: 18-180
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 4.53e-46
Family Pollen allergen PHL P 1 N-terminal domain 0.0024
Further Details:      
 
Domain Number 2 Region: 159-251
Classification Level Classification E-value
Superfamily PHL pollen allergen 1.57e-26
Family PHL pollen allergen 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087GTK2
Sequence length 255
Comment (tr|A0A087GTK2|A0A087GTK2_ARAAL) Uncharacterized protein {ECO:0000313|EMBL:KFK33204.1} KW=Complete proteome; Reference proteome OX=50452 OS=Arabis alpina (Alpine rock-cress). GN=AALP_AA6G344300 OC=Arabis.
Sequence
MKFLEKIIYAEVLMMVMVIWVVPICYGHGDHPGWLDARATFYGDINGGETQQGACGYGDL
HKQGYGLETAALSTALFNNGSTCGACYELKCVNSPQWCVPGIIKITATNFCPPDYSKTTD
IWCNPPQRDFDLSQKMYLKIAKYKAGVVPVKYRRVPCTKTGGVKFETKGNPHFLMVLPYN
IGGAGDVRALQVKGTKTAWIKMQKNWGQIWNTGVVLTGQCLSFRVTLSDGMTKDFINVTT
PSWSCGQTFDGRINF
Download sequence
Identical sequences A0A087GTK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]