SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087HBS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087HBS4
Domain Number 1 Region: 24-68
Classification Level Classification E-value
Superfamily Prefoldin 0.0000602
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087HBS4
Sequence length 100
Comment (tr|A0A087HBS4|A0A087HBS4_ARAAL) Uncharacterized protein {ECO:0000313|EMBL:KFK39576.1} KW=Complete proteome; Reference proteome OX=50452 OS=Arabis alpina (Alpine rock-cress). GN=AALP_AA3G262200 OC=Arabis.
Sequence
MEAGSSNSSGQLSGRVVDTRGKHRIQAELKRLEQEARFLEEEMEQLEKMENASASCKEFL
ESVESKPDPLLPETTGPVNATWDQWFERPKEAKRCGCTIL
Download sequence
Identical sequences A0A087HBS4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]