SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087HMS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087HMS0
Domain Number 1 Region: 26-253
Classification Level Classification E-value
Superfamily t-snare proteins 5.89e-48
Family t-snare proteins 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087HMS0
Sequence length 298
Comment (tr|A0A087HMS0|A0A087HMS0_ARAAL) Uncharacterized protein {ECO:0000313|EMBL:KFK43422.1} KW=Complete proteome; Reference proteome OX=50452 OS=Arabis alpina (Alpine rock-cress). GN=AALP_AA1G123800 OC=Arabis.
Sequence
MNDLFSNSFKRNQAQLGDVESGQETMNLDKFFEDVENVKDDMKGIETLYKKLQDSNEECK
TVHNAKKVKELRAKMDGDVAMVLKRVKMIKQKLEALEKANANSRNVPGCGPGSSTDRTRS
SVVSGLGKKLKDLMDSFQGLRARMNNEYKETVERRYFTITGEKADEQTIDNLIESGESEN
FLQKAIQEQGRGQIMDTISEIQERHDAVKEIEKNLLELHQVFLDMAALVEAQGQQLNNIE
SHVAKASSFVRRGTDQLQDAREYQKSSRKWTCYAIILFIVIFVLLLIPALPHIMLMLK
Download sequence
Identical sequences A0A087HMS0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]